Streptomyces viridosporus: CP969_06360 Help Entry CP969_06360       CDS       T07568                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism svd  Streptomyces viridosporus Pathway svd00261   Monobactam biosynthesis svd01100   Metabolic pathways svd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP969_06360  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:svd01008]     CP969_06360 Polyketide biosynthesis proteins [BR:svd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP969_06360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEU84351 UniProt:  A0A5J6FSK6 LinkDB All DBs Position 1343786..1344037 Genome browser AA seq 83 aa AA seqDB search MTQPHSTAGAGTGEARPDTDEVYLVVRNDEEQYSIWRADREVPAGWHPEGRRGSRQECLD HIGVIWTDMRPLSLRRRLAGADV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgacgcaaccccactccacggccggcgcgggcaccggcgaggcccgtccggacaccgac gaggtgtacctcgtggtgcgcaacgacgaggagcagtactcgatctggcgggcggaccgc gaggtgcccgccggctggcacccggagggccggcggggcagccggcaggagtgcctggac cacatcggcgtgatctggacggacatgcgcccgctcagcctgcgccgccggctggccggg gcggatgtctga

DBGET integrated database retrieval system