Streptomyces violascens: HWN34_16100 Help Entry HWN34_16100       CDS       T08842                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism svio  Streptomyces violascens Pathway svio00261   Monobactam biosynthesis svio01100   Metabolic pathways svio01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svio00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HWN34_16100  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:svio01008]     HWN34_16100 Polyketide biosynthesis proteins [BR:svio01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HWN34_16100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH APOC4 Motif Other DBs NCBI-ProteinID:  QLA57949 LinkDB All DBs Position complement(3697340..3697549) Genome browser AA seq 69 aa AA seqDB search MTNPFDDPRTHHRVLVNDEGQHALWPSFAAVPAGWEAVFGPADQDACHAYVEEHWTDLTP RSARRTVAA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgacgaaccccttcgacgacccccgcacccaccaccgcgtcctcgtcaacgacgagggc cagcacgccctgtggccctccttcgccgccgtcccggcgggctgggaggccgtcttcggc cccgccgaccaggacgcctgccacgcctacgtcgaggagcactggaccgacctcaccccg cgcagcgcccgccgcaccgtcgccgcatga

DBGET integrated database retrieval system