Streptomyces violaceusniger: Strvi_8793 Help Entry Strvi_8793        CDS       T01602                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism svl  Streptomyces violaceusniger Pathway svl00261   Monobactam biosynthesis svl01100   Metabolic pathways svl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Strvi_8793  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:svl01008]     Strvi_8793 Polyketide biosynthesis proteins [BR:svl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Strvi_8793 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  AEM88096 UniProt:  G2PAS0 LinkDB All DBs Position complement(10184894..10185100) Genome browser AA seq 68 aa AA seqDB search MSNPFEDENGSYYVLVNDERQHSLWPAFAEVPAGWTVVHGQDNRQACLDYINENWTDMRP KSLIEAMG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgaggacgagaacggcagctactacgtgctggtcaacgacgagcgg cagcactcgctgtggccggccttcgcggaggtacccgcgggctggaccgtcgtccacggc caggacaaccgccaggcgtgcctggactacatcaacgagaactggaccgacatgcggccc aagagcctgatcgaggcgatgggctga

DBGET integrated database retrieval system