Streptomyces vinaceus: CP980_07455 Help Entry CP980_07455       CDS       T06865                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism svn  Streptomyces vinaceus Pathway svn00261   Monobactam biosynthesis svn01100   Metabolic pathways svn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP980_07455  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:svn01008]     CP980_07455 Polyketide biosynthesis proteins [BR:svn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP980_07455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV44919 UniProt:  A0A5J6J1R6 LinkDB All DBs Position complement(1671061..1671264) Genome browser AA seq 67 aa AA seqDB search MTETDESGYRVVRNDEEQYSIWRAGRELPAGWRAEGTEGTRQECLDHIAEVWTDMRPLSL RRRMAVS NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaccgagacggacgagagcggctaccgcgtcgtacgcaatgacgaggagcagtactcc atctggcgggccggccgggagctcccggccggctggcgggccgagggcacggagggcacc cgccaggagtgcctggaccacatcgccgaggtgtggacggacatgcgcccgctgagcctg cgccgccgcatggcggtctcctga

DBGET integrated database retrieval system