Streptomyces vinaceus: CP980_28485 Help Entry CP980_28485       CDS       T06865                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism svn  Streptomyces vinaceus Pathway svn00261   Monobactam biosynthesis svn01100   Metabolic pathways svn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP980_28485  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:svn01008]     CP980_28485 Polyketide biosynthesis proteins [BR:svn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP980_28485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV48495 UniProt:  A0A5J6JD99 LinkDB All DBs Position 6301720..6301929 Genome browser AA seq 69 aa AA seqDB search MSNPFENPEGTYLVLVNDEGQHSLWPDFAEIPDGWDVAKTADTRQACLDHIEQNWTDMRP KSLIAAMGG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagtaacccgttcgagaaccccgagggcacctacctggtcctggtcaatgacgaaggc cagcactccctgtggccggacttcgccgagatccccgacggatgggacgtggccaagacc gccgacacgcgccaggcctgcctcgaccacattgagcagaactggaccgacatgcggccc aagagtctcatcgccgcgatgggaggctga

DBGET integrated database retrieval system