Streptomyces vinaceus: CP980_28975 Help Entry CP980_28975       CDS       T06865                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism svn  Streptomyces vinaceus Pathway svn00261   Monobactam biosynthesis svn01100   Metabolic pathways svn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP980_28975  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:svn01008]     CP980_28975 Polyketide biosynthesis proteins [BR:svn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP980_28975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV48577 UniProt:  A0A5J6JBG5 LinkDB All DBs Position complement(6407236..6407418) Genome browser AA seq 60 aa AA seqDB search MFKVVVNHEEQHSIWPRDREVPPGWSEVGVAGSKDECLAYIRTAWPDITPLSVRRALSGS NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgttcaaggtcgtggtcaaccacgaggagcagcactccatatggccccgggatcgcgag gtcccgcccggctggtccgaggtcggggtggccggcagcaaggacgagtgcctggcgtac atacgcaccgcctggcccgacatcactccgctgagcgtccgccgggctctgtccgggtcg tga

DBGET integrated database retrieval system