Streptomyces viridifaciens: CP971_02340 Help Entry CP971_02340       CDS       T06960                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism svr  Streptomyces viridifaciens Pathway svr00261   Monobactam biosynthesis svr01100   Metabolic pathways svr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP971_02340  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:svr01008]     CP971_02340 Polyketide biosynthesis proteins [BR:svr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP971_02340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH APOC4 Motif Other DBs NCBI-ProteinID:  QEU98321 LinkDB All DBs Position 484398..484610 Genome browser AA seq 70 aa AA seqDB search MANPFEDPEAEYLVLVNDEGQHSLWPVFSPVPDGWQRVFGAAARQDCVDYVEQHWQDLRP KSLVAHLSGH NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggcgaacccgttcgaggaccccgaggccgagtacctcgtcctggtcaacgacgagggc cagcactcgctgtggccggtcttcagcccggtgcccgacggctggcagcgggtcttcggc gcggccgcgcgccaggactgcgtcgactacgtcgagcagcactggcaggacctgcggccg aagagcctggtcgcccacctgtccggccactga

DBGET integrated database retrieval system