Streptomyces viridifaciens: CP971_29500 Help Entry CP971_29500       CDS       T06960                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism svr  Streptomyces viridifaciens Pathway svr00261   Monobactam biosynthesis svr01100   Metabolic pathways svr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP971_29500  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:svr01008]     CP971_29500 Polyketide biosynthesis proteins [BR:svr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP971_29500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV02808 LinkDB All DBs Position 6630083..6630295 Genome browser AA seq 70 aa AA seqDB search MSELDDDRRYLVVLNDEEQYSVWPTERDVPAGWRAEGFEGTRQECLDHVSLVWTDMRPLS LRRAMETARD NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcgagctcgacgacgaccgccggtacctggtggtcctcaacgacgaggagcagtac tccgtctggccgaccgagcgggacgtcccggccggctggcgggcggagggcttcgagggc acccgccaggagtgcctggaccacgtgtccctggtgtggaccgacatgcgtccgctcagc ctgcggcgggccatggagaccgcccgggactga

DBGET integrated database retrieval system