Streptomyces violaceoruber: B1H20_00910 Help Entry B1H20_00910       CDS       T05124                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism svu  Streptomyces violaceoruber Pathway svu00261   Monobactam biosynthesis svu01100   Metabolic pathways svu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:svu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B1H20_00910  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:svu01008]     B1H20_00910 Polyketide biosynthesis proteins [BR:svu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B1H20_00910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ARF60099 UniProt:  A0A1V0U4D9 LinkDB All DBs Position 203585..203788 Genome browser AA seq 67 aa AA seqDB search MSDAPANPFDADGEFLVLTNAEGGHSLWPLFAAVPEGWSTAHGPCDRQDALDWISAHWAG PVAAPAR NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgcacccgccaaccccttcgacgcggacggggagttcctcgtcctgaccaac gcggagggcgggcactcgctgtggccgctgttcgccgcggtgcccgagggctggtcgacg gctcacggtccgtgcgaccggcaggacgcgctggactggatctccgcgcactgggccggt cccgtcgccgcccccgcgcggtga

DBGET integrated database retrieval system