Streptomyces xanthii: IAG42_36485 Help Entry IAG42_36485       CDS       T07861                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sxn  Streptomyces xanthii Pathway sxn00261   Monobactam biosynthesis sxn01100   Metabolic pathways sxn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sxn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     IAG42_36485  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sxn01008]     IAG42_36485 Polyketide biosynthesis proteins [BR:sxn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     IAG42_36485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNS09252 UniProt:  A0A7H1BKJ7 LinkDB All DBs Position unnamed1:183670..183888 Genome browser AA seq 72 aa AA seqDB search MSNPFEDAEGTYLVLVNHEAQYSLWPSFAEVPAGWTVALPATDRESALAHIGEQWTDMRP KSLADAMDGAAA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgaggacgccgaaggcacctacctggtcctggtcaaccacgaagcc cagtactcgctgtggccgtccttcgccgaggtgcccgccgggtggaccgtcgcccttccg gcgaccgaccgcgagagcgccctcgcccacatcggcgagcagtggaccgacatgcggccc aagtccctggccgacgccatggacggggccgcggcgtga

DBGET integrated database retrieval system