Streptomyces xanthophaeus: KPP03845_103636 Help Entry KPP03845_103636   CDS       T08962                                  Symbol mbtH_1 Name (GenBank) Protein MbtH   KO K05375   MbtH protein Organism sxt  Streptomyces xanthophaeus Pathway sxt00261   Monobactam biosynthesis sxt01100   Metabolic pathways sxt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sxt00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KPP03845_103636 (mbtH_1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sxt01008]     KPP03845_103636 (mbtH_1) Polyketide biosynthesis proteins [BR:sxt01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KPP03845_103636 (mbtH_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WCD87260 LinkDB All DBs Position complement(3985285..3985494) Genome browser AA seq 69 aa AA seqDB search MTTNPFEDPQGRFLVLVNDEKQHSLWPSFAEVPAGWRTAFGEDTREACLTYVEQNWTDLR PASLVAQQG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccaccaacccgttcgaggacccgcagggtcgcttccttgtcctggtcaacgacgag aagcagcactcgctgtggccctccttcgcggaggtccccgccggctggcggaccgccttc ggcgaggacacgcgcgaggcgtgcctgacgtacgtcgagcagaactggacggacctgcgc ccggcgagcctggtcgcccagcagggctga

DBGET integrated database retrieval system