Streptomyces yangpuensis: NRK68_04370 Help Entry NRK68_04370       CDS       T08585                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism syan  Streptomyces yangpuensis Pathway syan00261   Monobactam biosynthesis syan01100   Metabolic pathways syan01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:syan00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NRK68_04370  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:syan01008]     NRK68_04370 Polyketide biosynthesis proteins [BR:syan01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NRK68_04370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UUY51835 LinkDB All DBs Position complement(943873..944076) Genome browser AA seq 67 aa AA seqDB search MGPSPEDTVPTTHQVLVNHEGQYALYPATRETPDGWTPAGFDGTEDECAAFVDAHWPDIR PLSLRGA NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atcggcccgagcccggaggacaccgtgcccaccacccaccaggtcctcgtgaaccacgag gggcagtacgcgctgtaccccgccacgcgcgagacgcccgacggctggacgccggccggc ttcgacggcaccgaggacgaatgcgccgccttcgtcgacgcccactggcccgacatccgc ccgctcagcctgcgaggagcctga

DBGET integrated database retrieval system