Streptomyces yangpuensis: NRK68_31195 Help Entry NRK68_31195       CDS       T08585                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism syan  Streptomyces yangpuensis Pathway syan00261   Monobactam biosynthesis syan01100   Metabolic pathways syan01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:syan00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NRK68_31195  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:syan01008]     NRK68_31195 Polyketide biosynthesis proteins [BR:syan01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NRK68_31195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UUY51305 LinkDB All DBs Position 6895759..6895971 Genome browser AA seq 70 aa AA seqDB search MTTNPFDDAEGRFLVLVNDEGQHSLWPSFVDVPGGWTIALGETSREACLDYVEANWTDLR PRSLARSMDA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtgaccaccaaccccttcgacgacgccgagggccgcttcctcgtcctggtgaacgacgag ggccagcactcgctctggccgtccttcgtcgacgtgcccggcggctggacgatcgccctc ggcgagaccagccgggaggcctgcctggactacgtcgaagccaactggaccgatctgcgc ccccgttccctcgcccggtcgatggacgcctga

DBGET integrated database retrieval system