Synechococcus sp. WH 8109: Syncc8109_1663 Help Entry Syncc8109_1663    CDS       T03783                                  Symbol folB Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism syh  Synechococcus sp. WH 8109 Pathway syh00790   Folate biosynthesis syh01100   Metabolic pathways syh01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:syh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Syncc8109_1663 (folB) Enzymes [BR:syh01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Syncc8109_1663 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Syncc8109_1663 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Syncc8109_1663 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AHF64020 UniProt:  W0GUY5 LinkDB All DBs Position complement(1228579..1228950) Genome browser AA seq 123 aa AA seqDB search MDCIGVRDLRLWAHVGVLEHERRDGQWFRLDFSIQLDLKAAAVADDLSQSLDYGVAIQAL ESLSQQVRCLTIEHFSEQMLDRLETLYGPIPVWLRLTKCAAPVPGFNGRVFVERSRHGGR SAL NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggattgcatcggtgtgagggacctgcggttgtgggcccatgtcggggtgttggaacac gaacgtcgggatggtcaatggttcagacttgatttcagtattcagctcgatctcaaagct gctgcagtggccgacgacctgagccagagcctggactacggggtggcaattcaggcactg gaaagcttgtcccagcaggttcgttgcctcaccatcgagcacttcagtgagcagatgctg gatcggctggaaacgctgtacgggcccatcccggtctggctgcgattgaccaaatgtgct gcaccggttccaggatttaacggccgcgtgttcgtggaacgctcccgccatggcgggaga tcagccctgtga

DBGET integrated database retrieval system