Streptomyces yunnanensis: MOV08_00120 Help Entry MOV08_00120       CDS       T09344                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism syun  Streptomyces yunnanensis Pathway syun00261   Monobactam biosynthesis syun01100   Metabolic pathways syun01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:syun00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MOV08_00120  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:syun01008]     MOV08_00120 Polyketide biosynthesis proteins [BR:syun01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MOV08_00120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WEB37907 LinkDB All DBs Position complement(26721..26924) Genome browser AA seq 67 aa AA seqDB search MTHPFDDPDGVYQVLVNEEQQQSLWPRDVRAPAGWSPVFGPDTRDACVDYVESHWLDLRP ASTRAAR NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgacgcatcccttcgacgaccccgacggcgtctaccaggttctcgtcaacgaggaacag cagcaaagcctttggccgcgcgacgtccgcgcgcccgccggctggtcgccggtgttcggc ccggacacgcgggacgcctgcgtcgactacgtcgagtcccactggctcgacctgcgcccg gcctcgacgcgggcggctcggtga

DBGET integrated database retrieval system