Streptomyces yunnanensis: MOV08_12445 Help Entry MOV08_12445       CDS       T09344                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism syun  Streptomyces yunnanensis Pathway syun00261   Monobactam biosynthesis syun01100   Metabolic pathways syun01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:syun00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MOV08_12445  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:syun01008]     MOV08_12445 Polyketide biosynthesis proteins [BR:syun01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MOV08_12445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WEB40005 LinkDB All DBs Position complement(2857606..2857818) Genome browser AA seq 70 aa AA seqDB search MSANPFENDEAFYLVLRNTEGQHSLWPSFAEVPQGWEVAFGPQLRQECLEFVNENWTDMR PKSLIEAMGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtccgccaaccccttcgagaatgacgaagccttctacctggtgctccgcaacaccgag ggacagcactccctgtggcccagcttcgccgaggtcccccagggctgggaggtcgccttc ggcccgcaactgcgccaggaatgcctggaattcgtcaacgagaactggaccgacatgcgc cccaagtccctgatcgaggccatgggtgcctga

DBGET integrated database retrieval system