Streptomyces yunnanensis: MOV08_33770 Help Entry MOV08_33770       CDS       T09344                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism syun  Streptomyces yunnanensis Pathway syun00261   Monobactam biosynthesis syun01100   Metabolic pathways syun01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:syun00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MOV08_33770  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:syun01008]     MOV08_33770 Polyketide biosynthesis proteins [BR:syun01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MOV08_33770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH HPS6 Motif Other DBs NCBI-ProteinID:  WEB46010 LinkDB All DBs Position 7744636..7744857 Genome browser AA seq 73 aa AA seqDB search MMSNPFENPDATYLVLVNDEGQHSLWPESIEVPAGWTVAKTADTRDACLAYVEETWTDMR PASLVKAMAAAEA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atcatgagcaaccccttcgagaacccggacgccacctacctcgtgctcgtcaacgacgag ggccagcactcgctgtggcccgagtccatcgaggtgcccgccggctggaccgtcgccaag accgcggacacccgggacgcctgcctggcgtacgtcgaggagacctggacggacatgcgc ccggccagcctggtcaaggcgatggccgcagcggaggcctga

DBGET integrated database retrieval system