Tumebacillus algifaecis: CIG75_13295 Help Entry CIG75_13295       CDS       T04994                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism tab  Tumebacillus algifaecis Pathway tab00261   Monobactam biosynthesis tab01100   Metabolic pathways tab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tab00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CIG75_13295  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:tab01008]     CIG75_13295 Polyketide biosynthesis proteins [BR:tab01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CIG75_13295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ASS75852 UniProt:  A0A223D2L3 LinkDB All DBs Position complement(3132687..3132914) Genome browser AA seq 75 aa AA seqDB search MINPFEMTNGIYLVLKNEEGQYSLWPAFAFIPDGWDVVYGQASKEACLDFINSNWSDLRP TSLNRSEGAAAGEKR NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgatcaatccatttgaaatgacaaacgggatctacttggtattgaaaaatgaagaaggc cagtactcactctggccagccttcgcttttataccggacggttgggacgttgtgtacggg caagcgagcaaggaagcgtgtcttgattttatcaattcgaactggagcgatttgcgaccg actagcttgaatcggtcggagggcgcggctgctggtgaaaaacgatga

DBGET integrated database retrieval system