Tahibacter amnicola: N4264_17050 Help Entry N4264_17050       CDS       T09840                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism tamn  Tahibacter amnicola Pathway tamn00261   Monobactam biosynthesis tamn01100   Metabolic pathways tamn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tamn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     N4264_17050  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:tamn01008]     N4264_17050 Polyketide biosynthesis proteins [BR:tamn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     N4264_17050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UXI66448 LinkDB All DBs Position complement(4385983..4386201) Genome browser AA seq 72 aa AA seqDB search MSADRTDDTIYKVVVNHEEQYSIWPVDRENPLGWRDAGKSGPKEECLAYIREVWTDMRPL SLRKKMAESDLP NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgtccgccgacagaaccgacgacacgatctacaaagtcgtcgtcaatcacgaagagcaa tattcgatctggccagtcgaccgggagaaccccctgggctggcgcgatgccggaaaatcc ggcccgaaggaggaatgtctggcctacatccgcgaggtgtggacggacatgcggccgctg agtctgcgcaagaagatggcggagtcggacctgccatag

DBGET integrated database retrieval system