Leadbettera azotonutricia: TREAZ_1812 Help Entry TREAZ_1812        CDS       T01506                                  Name (GenBank) conserved domain protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism taz  Leadbettera azotonutricia Pathway taz00020   Citrate cycle (TCA cycle) taz01100   Metabolic pathways taz01110   Biosynthesis of secondary metabolites taz01120   Microbial metabolism in diverse environments taz01200   Carbon metabolism taz01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:taz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     TREAZ_1812 Enzymes [BR:taz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      TREAZ_1812 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_10 Fer4_21 Fer4_7 Fer4_9 Fer4_16 Fer4_15 Fer4_4 Fer4_3 Fer4_13 Fer4_8 Fer4_17 Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  AEF80210 UniProt:  F5YBZ2 LinkDB All DBs Position complement(553718..553948) Genome browser AA seq 76 aa AA seqDB search MARRGKVVIDRELCKGCFLCIRACPVKVLEEDTEPNSTGTYPTKAAHPEKCIACGSCFEV CPDVCIELFELEGAEA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggccaggagaggtaaagttgtcatcgaccgggaactgtgcaagggctgctttttatgc atccgcgcctgtccggtcaaggttttggaagaggatacggagccgaactccacgggtact tacccgacaaaggcggcccatcctgaaaagtgcatagcctgcgggagctgtttcgaagta tgccccgatgtctgcatcgagctttttgaacttgagggggcggaagcatga

DBGET integrated database retrieval system