Pseudoduganella chitinolytica: PX653_09415 Help Entry PX653_09415       CDS       T08857                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism tct  Pseudoduganella chitinolytica Pathway tct00261   Monobactam biosynthesis tct01100   Metabolic pathways tct01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tct00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PX653_09415  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:tct01008]     PX653_09415 Polyketide biosynthesis proteins [BR:tct01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PX653_09415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WEF34960 LinkDB All DBs Position complement(2137226..2137447) Genome browser AA seq 73 aa AA seqDB search MSQDYVNPFDDEQYRFSVLRNDQGQYSLWPEFAELPAGWESRFGPAARAECVEYVERHWQ AINPFARGVAGNA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagccaagactatgtgaacccgttcgacgacgaacaataccgtttctccgtgctgcgc aacgaccaaggccagtacagcctgtggcccgaattcgccgagctgccggccggctgggaa agccgtttcggcccggccgcgcgcgccgagtgcgtcgagtatgtcgagcggcactggcag gcgatcaatccgttcgcccgcggcgtcgccggcaacgcgtga

DBGET integrated database retrieval system