Thermomonospora curvata: Tcur_0386 Help Entry Tcur_0386         CDS       T01127                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism tcu  Thermomonospora curvata Pathway tcu00261   Monobactam biosynthesis tcu01100   Metabolic pathways tcu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tcu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Tcur_0386  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:tcu01008]     Tcur_0386 Polyketide biosynthesis proteins [BR:tcu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Tcur_0386 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACY95987 UniProt:  D1A2G7 LinkDB All DBs Position 438229..438435 Genome browser AA seq 68 aa AA seqDB search MTNPFEDPEADYLVLVNAEGRHSLWPVFAAVPAGWSTAFGPDRREACLEYVRTHWTDLRP RSLIEAHQ NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaccaacccgttcgaggaccccgaggccgactacctggtgctcgtcaacgccgagggc cggcactccctgtggccggtgttcgccgccgtccccgccggatggtccaccgcgttcggg cccgaccgccgcgaggcgtgcctggagtatgtccgcacccactggacggacctgcgtccg cgcagtctgatcgaggcgcatcagtga

DBGET integrated database retrieval system