Thermomonospora curvata: Tcur_1889 Help Entry Tcur_1889         CDS       T01127                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism tcu  Thermomonospora curvata Pathway tcu00261   Monobactam biosynthesis tcu01100   Metabolic pathways tcu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tcu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Tcur_1889  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:tcu01008]     Tcur_1889 Polyketide biosynthesis proteins [BR:tcu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Tcur_1889 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACY97459 UniProt:  D1ACX0 LinkDB All DBs Position 2233205..2233420 Genome browser AA seq 71 aa AA seqDB search MSNPFEDPDGTFLVLVNDEGQYSLWPSFAEVPAGWTVAKSADTRQACLEFVEANWTDMRP KSLIEAMEGSA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgaggaccccgacggcacgttcctggtgctggtcaacgacgagggc cagtactcgctgtggccgtcgttcgccgaggtccccgccggctggacggtggccaagagc gccgacacccgccaggcgtgcctggagttcgtggaggccaactggaccgacatgcggccc aagagcctgatcgaggccatggagggctcggcttga

DBGET integrated database retrieval system