Triticum dicoccoides (wild emmer wheat): 119338003 Help Entry 119338003         CDS       T07278                                  Name (RefSeq) dihydroneopterin aldolase 1-like   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc00790   Folate biosynthesis tdc01100   Metabolic pathways tdc01240   Biosynthesis of cofactors Module tdc_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:tdc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     119338003 Enzymes [BR:tdc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      119338003  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      119338003  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      119338003 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-GeneID:  119338003 NCBI-ProteinID:  XP_037466188 LinkDB All DBs Position 7B:264802242..264805321 Genome browser AA seq 125 aa AA seqDB search MAGGGDKLILRGLQFHGFHGVKQEEKKLGQKFVIDVDAWMDLAAAGDSDDISHTVSYSDI YRIAKGVVEGPSRNLLESVAQSIANTTLLKFPQISAVRVKVGKPHVAVQGVVDYLGVEIL RHRNA NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggcggggggcggtgacaagctgatactgcgggggctgcagttccacgggttccacggc gtgaagcaggaggagaagaagctcggccagaagttcgtcattgacgtcgacgcctggatg gacctcgccgccgccggggactccgacgacatctcccacaccgtcagctacagcgacatc tacaggatagccaagggtgtagtagaaggtccgtcgcgtaaccttttggagtcggtggct caatcgattgccaacaccacgctgctcaagttccctcagatctctgctgttcgagtgaag gtcgggaaacctcatgtcgcggtgcaaggcgtcgtggactacttgggagtggagatactg aggcacagaaatgcatga

DBGET integrated database retrieval system