Triplophysa dalaica: 130414055 Help Entry 130414055         CDS       T09616                                  Symbol kras Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism tdw  Triplophysa dalaica Pathway tdw04010   MAPK signaling pathway tdw04012   ErbB signaling pathway tdw04068   FoxO signaling pathway tdw04137   Mitophagy - animal tdw04140   Autophagy - animal tdw04150   mTOR signaling pathway tdw04210   Apoptosis tdw04218   Cellular senescence tdw04370   VEGF signaling pathway tdw04371   Apelin signaling pathway tdw04540   Gap junction tdw04625   C-type lectin receptor signaling pathway tdw04810   Regulation of actin cytoskeleton tdw04910   Insulin signaling pathway tdw04912   GnRH signaling pathway tdw04914   Progesterone-mediated oocyte maturation tdw04916   Melanogenesis Brite KEGG Orthology (KO) [BR:tdw00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130414055 (kras)    04012 ErbB signaling pathway     130414055 (kras)    04370 VEGF signaling pathway     130414055 (kras)    04371 Apelin signaling pathway     130414055 (kras)    04068 FoxO signaling pathway     130414055 (kras)    04150 mTOR signaling pathway     130414055 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130414055 (kras)    04137 Mitophagy - animal     130414055 (kras)   09143 Cell growth and death    04210 Apoptosis     130414055 (kras)    04218 Cellular senescence     130414055 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     130414055 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130414055 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     130414055 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     130414055 (kras)    04912 GnRH signaling pathway     130414055 (kras)    04914 Progesterone-mediated oocyte maturation     130414055 (kras)    04916 Melanogenesis     130414055 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tdw04131]     130414055 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:tdw04031]     130414055 (kras) Membrane trafficking [BR:tdw04131]  Endocytosis   Macropinocytosis    Ras GTPases     130414055 (kras) GTP-binding proteins [BR:tdw04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     130414055 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin G1_gp67_C Motif Other DBs NCBI-GeneID:  130414055 NCBI-ProteinID:  XP_056595676 EnsemblRapid:  ENSTDLG00000017354 LinkDB All DBs Position 24:12621053..12629233 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRSVDTKQAQDLARSYGIPFIETSAKTRQRVEDGFYTLVREIRQYRLRKYSKEEKTPRC IKLKKCALM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatataagcttgtggtcgtgggggctggaggcgttggcaagagcgcacttacc atccagctcatccagaaccactttgtggatgaatacgacccaaccatagaggactcctac aggaagcaggtggtgatcgatggagagacatgtctactggacatcttggacactgcaggt caggaggagtacagcgctatgagagaccagtacatgaggacgggagagggcttcctctgc gtctttgccatcaataatacaaagtccttcgaggacattcatcactacagagagcaaata aagcgagtcaaggattccgaagatgtccccatggtccttgtggggaacaagtgtgatctt ccgtcccgctctgtggacaccaagcaggctcaggatttagcacgtagctacggcattcca tttatagagacctcagcaaagacgagacagagagtggaagatggcttttatactctagta cgggagataaggcaataccggctgagaaaatacagtaaagaagaaaagacgccacggtgc atcaagctaaaaaaatgtgctttgatgtaa

DBGET integrated database retrieval system