Taylorella equigenitalis 14/56: KUK_0972 Help Entry KUK_0972          CDS       T02604                                  Symbol folB Name (GenBank) FolB protein   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism teg  Taylorella equigenitalis 14/56 Pathway teg00790   Folate biosynthesis teg01100   Metabolic pathways teg01240   Biosynthesis of cofactors Module teg_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:teg00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     KUK_0972 (folB) Enzymes [BR:teg01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      KUK_0972 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      KUK_0972 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      KUK_0972 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  CCG18269 UniProt:  I7IB68 LinkDB All DBs Position 1053421..1053789 Genome browser AA seq 122 aa AA seqDB search MSQMKIFFNKLKIDAKIGILEHELRATQIIEVDVVLDILTPSAVDDKNIKTVLDYRKIRD IIREESVRQHVHLVETLLLTISARLYKEFDVIEAIDLKIGKPAAFSDSDAVGVQLISTRS DF NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgtctcagatgaaaatattttttaataagcttaaaatcgatgcgaagattggaatactt gagcacgagctaagggccactcaaattattgaagttgatgtggtactcgacatactaact ccgtctgcggttgatgataaaaatataaaaactgttttggattacagaaaaattcgtgac attattagagaagagtctgttaggcagcatgtacatttagttgaaacactactcttaact atttccgccagactttataaagaatttgatgtgattgaagctatagatcttaagattgga aaaccagcagccttttctgattcggatgctgttggcgtgcagcttatttctacgcgttca gatttctaa

DBGET integrated database retrieval system