Tachysurus fulvidraco (yellow catfish): 113660103 Help Entry 113660103         CDS       T08119                                  Symbol kras Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd04010   MAPK signaling pathway tfd04012   ErbB signaling pathway tfd04068   FoxO signaling pathway tfd04137   Mitophagy - animal tfd04140   Autophagy - animal tfd04150   mTOR signaling pathway tfd04210   Apoptosis tfd04218   Cellular senescence tfd04370   VEGF signaling pathway tfd04371   Apelin signaling pathway tfd04540   Gap junction tfd04625   C-type lectin receptor signaling pathway tfd04810   Regulation of actin cytoskeleton tfd04910   Insulin signaling pathway tfd04912   GnRH signaling pathway tfd04914   Progesterone-mediated oocyte maturation tfd04916   Melanogenesis Brite KEGG Orthology (KO) [BR:tfd00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113660103 (kras)    04012 ErbB signaling pathway     113660103 (kras)    04370 VEGF signaling pathway     113660103 (kras)    04371 Apelin signaling pathway     113660103 (kras)    04068 FoxO signaling pathway     113660103 (kras)    04150 mTOR signaling pathway     113660103 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113660103 (kras)    04137 Mitophagy - animal     113660103 (kras)   09143 Cell growth and death    04210 Apoptosis     113660103 (kras)    04218 Cellular senescence     113660103 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     113660103 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     113660103 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113660103 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     113660103 (kras)    04912 GnRH signaling pathway     113660103 (kras)    04914 Progesterone-mediated oocyte maturation     113660103 (kras)    04916 Melanogenesis     113660103 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tfd04131]     113660103 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:tfd04031]     113660103 (kras) Membrane trafficking [BR:tfd04131]  Endocytosis   Macropinocytosis    Ras GTPases     113660103 (kras) GTP-binding proteins [BR:tfd04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     113660103 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase G-alpha ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  113660103 NCBI-ProteinID:  XP_027029161 LinkDB All DBs Position 10:12026421..12034248 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKLSKEEETPRC IKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagctggtggtggtcggggctggaggcgttggaaaaagtgctctcacc atccagctcatccagaaccactttgtagatgaatatgaccctactatagaggactcgtac aggaagcaggtggtgattgacggagagacgtgtttgttggacatcctggacacagcaggt caggaggagtacagcgccatgagagatcaatacatgaggacaggagagggcttcctctgt gtttttgccattaataacaccaagtcttttgaggacattcaccactacagagagcagatt aagagagtgaaagactcagaggatgtgcctatggtcctggtgggaaataagtgtgacctg ccgtcccgcacagtggataccaagcaggctcaggacttagcacgtagctatggaattcct ttcatcgagacctcggcaaaaacgagacagagagtggaggatgccttttacactctggtc cgggagatcaggcaatacagactgaaaaaactcagcaaagaagaagagacgccgaggtgc atcaagcttaaaaaatgtgttgtgatgtga

DBGET integrated database retrieval system