Takifugu flavidus (sansaifugu): 130514432 Help Entry 130514432         CDS       T09160                                  Symbol zgc:55558 Name (RefSeq) GTPase KRas   KO K07827   GTPase KRas Organism tfs  Takifugu flavidus (sansaifugu) Pathway tfs04010   MAPK signaling pathway tfs04012   ErbB signaling pathway tfs04068   FoxO signaling pathway tfs04137   Mitophagy - animal tfs04140   Autophagy - animal tfs04150   mTOR signaling pathway tfs04210   Apoptosis tfs04218   Cellular senescence tfs04370   VEGF signaling pathway tfs04371   Apelin signaling pathway tfs04540   Gap junction tfs04625   C-type lectin receptor signaling pathway tfs04810   Regulation of actin cytoskeleton tfs04910   Insulin signaling pathway tfs04912   GnRH signaling pathway tfs04914   Progesterone-mediated oocyte maturation tfs04916   Melanogenesis Brite KEGG Orthology (KO) [BR:tfs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130514432 (zgc:55558)    04012 ErbB signaling pathway     130514432 (zgc:55558)    04370 VEGF signaling pathway     130514432 (zgc:55558)    04371 Apelin signaling pathway     130514432 (zgc:55558)    04068 FoxO signaling pathway     130514432 (zgc:55558)    04150 mTOR signaling pathway     130514432 (zgc:55558)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130514432 (zgc:55558)    04137 Mitophagy - animal     130514432 (zgc:55558)   09143 Cell growth and death    04210 Apoptosis     130514432 (zgc:55558)    04218 Cellular senescence     130514432 (zgc:55558)   09144 Cellular community - eukaryotes    04540 Gap junction     130514432 (zgc:55558)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130514432 (zgc:55558)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     130514432 (zgc:55558)   09152 Endocrine system    04910 Insulin signaling pathway     130514432 (zgc:55558)    04912 GnRH signaling pathway     130514432 (zgc:55558)    04914 Progesterone-mediated oocyte maturation     130514432 (zgc:55558)    04916 Melanogenesis     130514432 (zgc:55558)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tfs04131]     130514432 (zgc:55558)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:tfs04031]     130514432 (zgc:55558) Membrane trafficking [BR:tfs04131]  Endocytosis   Macropinocytosis    Ras GTPases     130514432 (zgc:55558) GTP-binding proteins [BR:tfs04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     130514432 (zgc:55558) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 Septin SatRNA_48 Sua5_yciO_yrdC AAA_16 Motif Other DBs NCBI-GeneID:  130514432 NCBI-ProteinID:  XP_056869993 LinkDB All DBs Position 18:complement(5554199..5558025) Genome browser AA seq 187 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDVHLYREQINRVKDSDSVPMVLVGNKSDL STRMVETRQAQELARSYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKNT QRRCVIL NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggttggagctggaggcgttgggaagagcgctctcacc atccagctcatccagaatcactttgtggacgaatatgatccaacaatcgaggactcttac agaaaacaggtggtgatcgatggggagacctgcctgttggacatcctggacactgcaggt caggaggagtacagtgccatgagggatcagtacatgaggacgggagagggtttcctctgc gtctttgccatcaataacaccaagtcctttgaggatgttcacctctacagagagcagatt aacagggtgaaggacagtgacagtgtccccatggtgctggtggggaacaagagcgacctg agcactcgcatggtggagacccgacaagcgcaggagctggcacgaagttacggagtcccg tttgtggagacttctgccaaaaccagacagggcgtggaggaggcattctattcgctagta cgggagattagaaggtataaggagaccaatcgtagcaacaagaagagcaagaagaacact caaagacgttgcgtaatcctatag

DBGET integrated database retrieval system