Theropithecus gelada (gelada): 112604696 Help Entry 112604696         CDS       T08041                                  Symbol IL1B Name (RefSeq) interleukin-1 beta isoform X1   KO K04519   interleukin 1 beta Organism tge  Theropithecus gelada (gelada) Pathway tge01523   Antifolate resistance tge04010   MAPK signaling pathway tge04060   Cytokine-cytokine receptor interaction tge04064   NF-kappa B signaling pathway tge04217   Necroptosis tge04380   Osteoclast differentiation tge04620   Toll-like receptor signaling pathway tge04621   NOD-like receptor signaling pathway tge04623   Cytosolic DNA-sensing pathway tge04625   C-type lectin receptor signaling pathway tge04640   Hematopoietic cell lineage tge04657   IL-17 signaling pathway tge04659   Th17 cell differentiation tge04668   TNF signaling pathway tge04750   Inflammatory mediator regulation of TRP channels tge04932   Non-alcoholic fatty liver disease tge04933   AGE-RAGE signaling pathway in diabetic complications tge04936   Alcoholic liver disease tge04940   Type I diabetes mellitus tge05010   Alzheimer disease tge05020   Prion disease tge05022   Pathways of neurodegeneration - multiple diseases tge05132   Salmonella infection tge05133   Pertussis tge05134   Legionellosis tge05135   Yersinia infection tge05140   Leishmaniasis tge05142   Chagas disease tge05143   African trypanosomiasis tge05144   Malaria tge05146   Amoebiasis tge05152   Tuberculosis tge05162   Measles tge05163   Human cytomegalovirus infection tge05164   Influenza A tge05168   Herpes simplex virus 1 infection tge05171   Coronavirus disease - COVID-19 tge05321   Inflammatory bowel disease tge05323   Rheumatoid arthritis tge05332   Graft-versus-host disease tge05417   Lipid and atherosclerosis tge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112604696 (IL1B)    04064 NF-kappa B signaling pathway     112604696 (IL1B)    04668 TNF signaling pathway     112604696 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112604696 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112604696 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     112604696 (IL1B)    04620 Toll-like receptor signaling pathway     112604696 (IL1B)    04621 NOD-like receptor signaling pathway     112604696 (IL1B)    04623 Cytosolic DNA-sensing pathway     112604696 (IL1B)    04625 C-type lectin receptor signaling pathway     112604696 (IL1B)    04659 Th17 cell differentiation     112604696 (IL1B)    04657 IL-17 signaling pathway     112604696 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     112604696 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     112604696 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     112604696 (IL1B)    05164 Influenza A     112604696 (IL1B)    05162 Measles     112604696 (IL1B)    05168 Herpes simplex virus 1 infection     112604696 (IL1B)    05163 Human cytomegalovirus infection     112604696 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     112604696 (IL1B)    05135 Yersinia infection     112604696 (IL1B)    05133 Pertussis     112604696 (IL1B)    05134 Legionellosis     112604696 (IL1B)    05152 Tuberculosis     112604696 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     112604696 (IL1B)    05144 Malaria     112604696 (IL1B)    05140 Leishmaniasis     112604696 (IL1B)    05142 Chagas disease     112604696 (IL1B)    05143 African trypanosomiasis     112604696 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     112604696 (IL1B)    05321 Inflammatory bowel disease     112604696 (IL1B)    05332 Graft-versus-host disease     112604696 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     112604696 (IL1B)    05020 Prion disease     112604696 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     112604696 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112604696 (IL1B)    05418 Fluid shear stress and atherosclerosis     112604696 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     112604696 (IL1B)    04936 Alcoholic liver disease     112604696 (IL1B)    04932 Non-alcoholic fatty liver disease     112604696 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     112604696 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     112604696 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112604696 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:tge00536]     112604696 (IL1B) Cytokines and neuropeptides [BR:tge04052]  Cytokines   Interleukins    112604696 (IL1B) Glycosaminoglycan binding proteins [BR:tge00536]  Heparan sulfate / Heparin   Cytokines    112604696 (IL1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  112604696 NCBI-ProteinID:  XP_025209799 Ensembl:  ENSTGEG00000028649 LinkDB All DBs Position 13:4596200..4603343 Genome browser AA seq 285 aa AA seqDB search MNTAYLAADTLKVSEVAMAEVPELASEMMAYYSGNEDDLFFEVDGPKQMKCSFQDLDLCP LDGGIQLQISHEHYNKGFRQAVSVVVAMEKLRKMLVPCPQTFQDNDLSTLIPFIFEEEPV FLDTCNNDACVHDAPVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFV QGEESNDKVPVALGLKAKNLYLACVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEIN NKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTMQFAS NT seq 858 nt NT seq  +upstreamnt  +downstreamnt atgaatactgcttatctagcagctgacaccctaaaggtgtctgaagtagccatggcagaa gtacctgaactcgccagtgaaatgatggcttactacagcggcaacgaggatgacttgttc tttgaagtcgatggccctaaacagatgaagtgctccttccaggatctagacctctgccct ctggatggcggcatccagctacaaatctcccacgagcactacaacaagggcttccggcag gccgtgtcggttgttgtagccatggagaagctaaggaagatgctggttccctgcccacag accttccaggacaatgacctgagcaccttgattcccttcatctttgaagaagaacctgtc ttcctcgacacatgcaataacgacgcttgtgtgcacgatgcacctgtacgatcactgcac tgcacactccgggatgcacagctcaaaagcttggtgatgtctggtccatatgaactgaaa gctctccacctccagggacaggatctggagcaacaagtggtgttctccatgtcctttgta caaggagaagaaagtaatgacaaagtacctgtggccttgggcctcaaggcaaagaacctg tacctggcctgcgtgttgaaagatgataagcccacgctacagctggagagtgtagatccc aaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagatagaaatcaat aacaagctggaatttgagtctgcccaattccccaactggtacatcagcacctctcaagca gaaaatatgcccgtcttcctgggagggaccagaggtggccaggatataactgatttcacc atgcaatttgcgtcttga

DBGET integrated database retrieval system