Thermobifida halotolerans: NI17_011410 Help Entry NI17_011410       CDS       T08032                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism thao  Thermobifida halotolerans Pathway thao00261   Monobactam biosynthesis thao01100   Metabolic pathways thao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thao00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NI17_011410  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:thao01008]     NI17_011410 Polyketide biosynthesis proteins [BR:thao01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NI17_011410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UOE21646 UniProt:  A0A399G974 LinkDB All DBs Position complement(2564507..2564722) Genome browser AA seq 71 aa AA seqDB search MTNPFDDDEGVFLVLVNDEDQHSLWPEFAEVPQGWRTVFGPASRAEALDYVNTHWTDLRP RSLRRAMEQRG NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgaccaatccgttcgacgacgacgaaggcgtgttcctcgtcctggtcaacgacgaggac cagcactccctgtggcccgagttcgccgaggtcccacaggggtggcgcaccgtgttcgga cccgcctcgcgcgccgaggccctggactacgtcaacacccactggaccgacctgcggccg cgcagcctccgccgggccatggagcagcgggggtag

DBGET integrated database retrieval system