Candidatus Tokpelaia hoelldoblerii: BHV28_07250 Help Entry BHV28_07250       CDS       T04701                                  Symbol mbtH Name (GenBank) Protein MbtH   KO K05375   MbtH protein Organism thd  Candidatus Tokpelaia hoelldoblerii Pathway thd00261   Monobactam biosynthesis thd01100   Metabolic pathways thd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BHV28_07250 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:thd01008]     BHV28_07250 (mbtH) Polyketide biosynthesis proteins [BR:thd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BHV28_07250 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AQS41425 UniProt:  A0A1U9JU84 LinkDB All DBs Position 745206..745406 Genome browser AA seq 66 aa AA seqDB search MKNPFENEQLVFCVLVNHEHQHSLWPDFIQIPKGWERVFGPESRQLCLDYINENWQDIKP KSLTGS NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgaaaaatccatttgaaaatgaacagttagtgttttgtgttttagttaaccatgagcat cagcattctctgtggcctgattttattcagataccaaaagggtgggaacgggtttttggg ccggaaagccgccagttatgcttggattatatcaatgaaaactggcaggacataaaacct aaaagcctgaccggttcataa

DBGET integrated database retrieval system