Thermococcus sp. 4557: GQS_09155 Help Entry GQS_09155         CDS       T01588                                  Name (GenBank) hypothetical protein   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism the  Thermococcus sp. 4557 Pathway the00290   Valine, leucine and isoleucine biosynthesis the00650   Butanoate metabolism the00770   Pantothenate and CoA biosynthesis the01100   Metabolic pathways the01110   Biosynthesis of secondary metabolites the01210   2-Oxocarboxylic acid metabolism the01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:the00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     GQS_09155    00660 C5-Branched dibasic acid metabolism     GQS_09155   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     GQS_09155   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     GQS_09155 Enzymes [BR:the01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      GQS_09155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT ACT_4 ACT_6 Motif Other DBs NCBI-ProteinID:  AEK73725 UniProt:  G0HN74 LinkDB All DBs Position 1738300..1738707 Genome browser AA seq 135 aa AA seqDB search MRHYEIVKIRENGKVELPMDYAYELGVVEGAYFLLEIDTDLKEIHLERVALPGKKLVEVE LVVEDRPGVLARISGLFGRHGANILFSESEELGAIGLAGIVAVVDVSGMRTTLDGLKNEL ASLSEVKEVHLNPLE NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgagacactacgagatagtcaagataagggagaacggcaaggttgagctgcccatggat tacgcctacgagcttggcgtggtggagggtgcttattttctcctcgagatagacaccgac ctcaaggagattcacctggaacgggtggccctgcccggaaagaagctcgtggaggttgag ctcgttgtggaggaccggcccggtgttctggccaggatcagcggtctcttcggcaggcac ggggccaacatactcttcagcgagtcggaggagctcggtgccatcggcctggccggcatc gtcgctgtcgtggacgtgagcgggatgcgcacgacccttgatggcctgaaaaatgaactc gcctccctgtccgaggtgaaggaggttcatctaaaccccctggagtag

DBGET integrated database retrieval system