Thermococcus argininiproducens: K1720_10550 Help Entry K1720_10550       CDS       T08316                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism thei  Thermococcus argininiproducens Pathway thei00020   Citrate cycle (TCA cycle) thei00720   Carbon fixation pathways in prokaryotes thei01100   Metabolic pathways thei01110   Biosynthesis of secondary metabolites thei01120   Microbial metabolism in diverse environments thei01200   Carbon metabolism thei01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:thei00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     K1720_10550   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     K1720_10550 Enzymes [BR:thei01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      K1720_10550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_2 Fer4_9 Fer4_6 Fer4_10 ETF_QO Fer4_8 Fer4_4 Fer4_13 Fer4_16 Fer4_22 Fer4_17 Fer4_15 Fer4_3 Motif Other DBs NCBI-ProteinID:  USG99902 UniProt:  A0A9E7MAZ7 LinkDB All DBs Position complement(1936860..1937117) Genome browser AA seq 85 aa AA seqDB search MANVEVKKEGYLSIGKTEAVEISVDTFLCKGCGICLELCPRTVFEWSKELSEKGVHYPLP VNAEKCVKCKLCELLCPDFAIAVKW NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcaaatgtcgaagttaaaaaggaaggatatttgtctattgggaaaacggaggcagtt gagataagcgtggacactttcctatgcaaggggtgtggtatctgcctagaactttgccca agaacggtttttgaatggagcaaagaacttagtgaaaaaggcgttcattatccccttccc gtgaatgcagagaagtgtgtgaaatgtaaactttgtgaactcctgtgtcctgactttgct atagctgttaagtggtga

DBGET integrated database retrieval system