Thermococcus aciditolerans: FPV09_03050 Help Entry FPV09_03050       CDS       T07677                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism them  Thermococcus aciditolerans Pathway them00020   Citrate cycle (TCA cycle) them00720   Carbon fixation pathways in prokaryotes them01100   Metabolic pathways them01110   Biosynthesis of secondary metabolites them01120   Microbial metabolism in diverse environments them01200   Carbon metabolism them01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:them00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     FPV09_03050   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     FPV09_03050 Enzymes [BR:them01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      FPV09_03050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_21 Fer4_9 Fer4_10 Fer4_8 Fer4_6 Fer4_13 ETF_QO Fer4_16 Fer4_4 Fer4_22 Fer4_17 Fer4_3 Fer4_15 Motif Other DBs NCBI-ProteinID:  QEK15757 UniProt:  A0A5C0SPR1 LinkDB All DBs Position 561835..562107 Genome browser AA seq 90 aa AA seqDB search MAAVEGKTVVVKENYLVTGKAEGVVEIDVDTFLCKGCGVCVEMCPRKVFEWSKELSEKGV HYPVPVNAEKCVKCKLCELLCPDFAIAVRW NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggcagctgtcgaagggaaaaccgttgtcgtgaaggagaactacctcgttaccggcaag gcggaaggtgttgttgaaatcgacgtcgacacttttctctgcaagggctgcggtgtttgc gttgaaatgtgcccgagaaaagtgtttgagtggagcaaggagctcagcgaaaagggcgtt cactacccggttcctgttaacgccgagaagtgcgtcaagtgcaagctctgcgagcttctc tgcccggactttgccatcgcggttaggtggtga

DBGET integrated database retrieval system