Thermosipho sp. 1070: Y592_02815 Help Entry Y592_02815        CDS       T04909                                  Name (GenBank) pyruvate synthase   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism ther  Thermosipho sp. 1070 Pathway ther00010   Glycolysis / Gluconeogenesis ther00020   Citrate cycle (TCA cycle) ther00620   Pyruvate metabolism ther00640   Propanoate metabolism ther00650   Butanoate metabolism ther00680   Methane metabolism ther01100   Metabolic pathways ther01110   Biosynthesis of secondary metabolites ther01120   Microbial metabolism in diverse environments ther01200   Carbon metabolism ther01210   2-Oxocarboxylic acid metabolism Module ther_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:ther00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     Y592_02815    00020 Citrate cycle (TCA cycle)     Y592_02815    00620 Pyruvate metabolism     Y592_02815    00640 Propanoate metabolism     Y592_02815    00650 Butanoate metabolism     Y592_02815   09102 Energy metabolism    00680 Methane metabolism     Y592_02815   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     Y592_02815 Enzymes [BR:ther01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      Y592_02815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_9 Fer4_10 Fer4_4 Fer4_2 Fer4_17 Fer4_16 Fer4_13 Fer4_8 Fer4_3 Fer4_15 ETF_QO Fer4_18 Fer4_22 Motif Other DBs NCBI-ProteinID:  ANQ53445 LinkDB All DBs Position 558859..559191 Genome browser AA seq 110 aa AA seqDB search MAELKGWKEIPIGGVIDKPATAKEYQTGTWRVIRPVHQPENCIHCMMCWLYCPDQAIVIE VVDGKPKMKGYNYYYCKGCGLCANVCPKTNDKLPEEKRAIVMKPETEFQD NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggctgaactcaaaggttggaaagagataccaattggtggtgtaatagataaaccggca acagctaaagaatatcaaacaggtacctggagagttattagacctgtccatcaacccgaa aattgtatacactgtatgatgtgttggctttattgtcctgatcaagcaatagtaattgag gttgttgacggaaagccaaaaatgaaaggttacaattattactactgtaaagggtgcggt ctttgcgctaatgtttgtccaaagacaaatgataaattacccgaagaaaaaagagctatt gtcatgaaacctgaaacggaatttcaagattga

DBGET integrated database retrieval system