Thermodesulfomicrobium sp. WS: TDMWS_19290 Help Entry TDMWS_19290       CDS       T08730                                  Name (GenBank) (Fe-S)-binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism thew  Thermodesulfomicrobium sp. WS Pathway thew00020   Citrate cycle (TCA cycle) thew01100   Metabolic pathways thew01110   Biosynthesis of secondary metabolites thew01120   Microbial metabolism in diverse environments thew01200   Carbon metabolism thew01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:thew00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     TDMWS_19290 Enzymes [BR:thew01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      TDMWS_19290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_10 Fer4_9 Fer4_6 Fer4_2 Fer4_16 Fer4_4 Fer4_17 Fer4_3 Fer4_8 Fer4_18 Fer4_15 Fer4_22 Motif Other DBs NCBI-ProteinID:  BDV01844 LinkDB All DBs Position 2081310..2081537 Genome browser AA seq 75 aa AA seqDB search MPSRVQFREDRCKGCLLCVQACPSGIIQQSSRFNQQGYKVAEVPAERMAECKGCAFCALM CPDFAIHVFKTKEAA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgccaagccgcgtccaattccgggaagaccgctgcaaaggctgcctgctctgtgtccag gcctgccccagcggcatcatccagcaatcttcccgtttcaaccaacagggctacaaagta gccgaagtccctgccgaacgcatggcggaatgcaaaggctgcgccttttgcgccctcatg tgcccggatttcgccatccatgtcttcaaaaccaaggaggccgcatga

DBGET integrated database retrieval system