Infirmifilum uzonense: MA03_07665 Help Entry MA03_07665        CDS       T03924                                  Name (GenBank) ferredoxin   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism thf  Infirmifilum uzonense Pathway thf00010   Glycolysis / Gluconeogenesis thf00020   Citrate cycle (TCA cycle) thf00620   Pyruvate metabolism thf00633   Nitrotoluene degradation thf00640   Propanoate metabolism thf00650   Butanoate metabolism thf00680   Methane metabolism thf00720   Carbon fixation pathways in prokaryotes thf01100   Metabolic pathways thf01110   Biosynthesis of secondary metabolites thf01120   Microbial metabolism in diverse environments thf01200   Carbon metabolism thf01210   2-Oxocarboxylic acid metabolism Module thf_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:thf00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     MA03_07665    00020 Citrate cycle (TCA cycle)     MA03_07665    00620 Pyruvate metabolism     MA03_07665    00640 Propanoate metabolism     MA03_07665    00650 Butanoate metabolism     MA03_07665   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     MA03_07665    00680 Methane metabolism     MA03_07665   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     MA03_07665 Enzymes [BR:thf01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      MA03_07665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_10 Fer4_6 Fer4_7 Fer4_2 Fer4_9 Fer4_16 Fer4_15 Fer4_13 Fer4_8 Fer4_4 Fer4_17 Fer4_3 Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  AKG39138 UniProt:  A0A0F7FJN7 LinkDB All DBs Position 1455004..1455300 Genome browser AA seq 98 aa AA seqDB search MSESIVLKLKTWKDLPIGGVIPEPSTSLYNKTGNWRAMTPVLDEKKCIKCLLCWIHCPEP AIIRKDDDSVKIDYDYCKGCGICANVCPVHAIEMKLGV NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgagtgagagtatagtattaaagcttaagacctggaaggatctgcctattggaggcgtc atcccggagcccagcacgagcctttataacaagacggggaactggcgcgccatgaccccg gttctcgatgagaaaaaatgtataaagtgtctcttatgctggatccactgccccgagcct gccataatacgaaaggacgacgactccgtgaagatagactacgattactgcaagggatgc ggcatatgtgcaaatgtttgtcctgtacacgctatcgagatgaagctaggggtgtga

DBGET integrated database retrieval system