Thermococcus sp. P6: A3L12_05620 Help Entry A3L12_05620       CDS       T05739                                  Name (GenBank) lipoate--protein ligase   KO K03800   lipoate---protein ligase [EC:6.3.1.20] Organism thy  Thermococcus sp. P6 Pathway thy00785   Lipoic acid metabolism thy01100   Metabolic pathways thy01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:thy00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00785 Lipoic acid metabolism     A3L12_05620 Enzymes [BR:thy01000]  6. Ligases   6.3  Forming carbon-nitrogen bonds    6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)     6.3.1.20  lipoate---protein ligase      A3L12_05620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lip_prot_lig_C Motif Other DBs NCBI-ProteinID:  ASJ10814 UniProt:  A0A218PD69 LinkDB All DBs Position 1044879..1045163 Genome browser AA seq 94 aa AA seqDB search MGVKHHVGEQKARKGLIRVEFDERDGRAEHVRITGDFFVHPEEAIGELERRLEGRKIEEL EHLIDEFFSMRMDVEMPYVNVEDFKIALKRALKD NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgggtgtgaagcaccacgtcggcgagcaaaaggccagaaagggtctgatacgggtggag ttcgacgagagggatggacgggctgaacacgtcaggatcaccggggatttcttcgttcat cctgaggaagccatcggggagctcgaaagaaggcttgaagggagaaaaatcgaggaactg gagcaccttatagacgagttcttctccatgaggatggacgtggagatgccctacgtcaac gttgaggacttcaagatagccctcaagagggccctgaaggattga

DBGET integrated database retrieval system