Thermococcus indicus: FH039_06310 Help Entry FH039_06310       CDS       T07099                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tic  Thermococcus indicus Pathway tic00020   Citrate cycle (TCA cycle) tic00720   Carbon fixation pathways in prokaryotes tic01100   Metabolic pathways tic01110   Biosynthesis of secondary metabolites tic01120   Microbial metabolism in diverse environments tic01200   Carbon metabolism tic01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tic00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     FH039_06310   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     FH039_06310 Enzymes [BR:tic01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      FH039_06310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_21 Fer4_9 Fer4_10 Fer4_6 Fer4_8 Fer4_16 Fer4_13 ETF_QO Fer4_22 Fer4_4 Fer4_17 Fer4_3 Fer4_15 Motif Other DBs NCBI-ProteinID:  QDA32385 UniProt:  A0A4Y5SNT7 LinkDB All DBs Position complement(1141706..1141978) Genome browser AA seq 90 aa AA seqDB search MADVEGKTVVERSDYLVTGKAEGIVEIDVDTFLCKGCGICVEMCPRKVFEWSKELSEKGV HYPVPVNAEKCVKCKLCELLCPDFAIAVRW NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggcagatgtcgaagggaaaaccgtggttgagaggtctgactacctcgttaccggcaag gcggaaggaatcgttgaaatcgacgtggacacttttctgtgcaagggctgtggcatttgc gtcgagatgtgcccgagaaaagtgtttgaatggagcaaagagctcagcgagaagggcgtc cactatccggttccggttaatgctgagaagtgcgtcaagtgcaagctctgtgaactgctc tgccctgacttcgccatcgcggtaaggtggtga

DBGET integrated database retrieval system