Tissierella sp. MB52-C2: RBU61_03070 Help Entry RBU61_03070       CDS       T09678                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tiz  Tissierella sp. MB52-C2 Pathway tiz00020   Citrate cycle (TCA cycle) tiz01100   Metabolic pathways tiz01110   Biosynthesis of secondary metabolites tiz01120   Microbial metabolism in diverse environments tiz01200   Carbon metabolism tiz01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tiz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     RBU61_03070 Enzymes [BR:tiz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      RBU61_03070 BRITE hierarchy Motif Pfam:  Fer4_7 Fer4_6 Fer4 Fer4_10 Fer4_2 Fer4_21 Fer4_9 Fer4_15 Fer4_4 Fer4_8 Fer4_22 Fer4_16 Fer4_3 Fer4_17 Fer4_13 Fer4_18 Motif Other DBs NCBI-ProteinID:  WMM25665 UniProt:  A0AA51R1Q9 LinkDB All DBs Position 607051..607266 Genome browser AA seq 71 aa AA seqDB search MAKGKVTFNEDICKGCGLCTTVCPVKILALDKTKINAKGYHPASVTDPEKCIGCANCATI CPDVVITVERF NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggctaaaggtaaagtaacatttaatgaggacatctgtaagggatgtggactttgtaca actgtttgtcctgtaaagatacttgcattagataaaacaaaaataaatgcaaagggatac cacccagcatcagtaacagacccagaaaaatgtatcggttgtgcaaactgtgcaactatt tgtccagatgtagttattacagtagagagattctaa

DBGET integrated database retrieval system