Thermoanaerobacter kivui: TKV_c21280 Help Entry TKV_c21280        CDS       T03397                                  Name (GenBank) methylmalonyl-CoA mutase   KO K01849   methylmalonyl-CoA mutase, C-terminal domain [EC:5.4.99.2] Organism tki  Thermoanaerobacter kivui Pathway tki00280   Valine, leucine and isoleucine degradation tki00630   Glyoxylate and dicarboxylate metabolism tki00640   Propanoate metabolism tki01100   Metabolic pathways tki01120   Microbial metabolism in diverse environments tki01200   Carbon metabolism Brite KEGG Orthology (KO) [BR:tki00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     TKV_c21280    00640 Propanoate metabolism     TKV_c21280   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     TKV_c21280 Enzymes [BR:tki01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.2  methylmalonyl-CoA mutase      TKV_c21280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  B12-binding Motif Other DBs NCBI-ProteinID:  AIS53261 UniProt:  A0A097ATX3 LinkDB All DBs Position complement(2036190..2036441) Genome browser AA seq 83 aa AA seqDB search MWMNLLQGCLSIIARALRDAGMEVIYTGLRQTPEQIVEAAIQEDVDVVALSILSGTHNTL FPKITKLLKGLEIKGIEIVEGKK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtggatgaatttgctccaaggttgtctttctataattgcaagagctttaagagatgcc ggaatggaagtaatatacacagggctcagacaaactcctgagcaaatcgtagaagcagcc atacaagaagatgtggatgttgtcgctttaagtattttgtcggggactcacaacactttg tttcctaaaataacaaagcttttaaaaggtcttgagataaaaggaattgaaatagtggag ggcaaaaagtga

DBGET integrated database retrieval system