Thermotoga maritima MSB8: Tmari_0881 Help Entry Tmari_0881        CDS       T02663                                  Name (GenBank) Ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tmm  Thermotoga maritima MSB8 Pathway tmm00020   Citrate cycle (TCA cycle) tmm01100   Metabolic pathways tmm01110   Biosynthesis of secondary metabolites tmm01120   Microbial metabolism in diverse environments tmm01200   Carbon metabolism tmm01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tmm00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Tmari_0881 Enzymes [BR:tmm01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Tmari_0881 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_7 Fer4_10 Fer4_21 Fer4_9 Fer4_16 Fer4_4 Fer4_13 Fer4_3 Fer4_17 Fer4_8 Fer4_15 Fer4_22 Motif Other DBs NCBI-ProteinID:  AGL49806 LinkDB All DBs Position complement(902050..902247) Genome browser AA seq 65 aa AA seqDB search MGYKIVVNYDWCKACKLCAWACPTSAITSDEIGKPVTNENKCIGCLKCEKICPDMAIEIV SDENA NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgggttacaagatcgtggtgaattacgactggtgcaaagcgtgtaagctgtgcgcgtgg gcttgtccgactagtgccattacaagcgatgaaataggaaaacccgtgacaaacgaaaac aaatgcatcggatgtttaaaatgtgagaaaatatgtccggatatggccatagaaattgtg agtgatgagaatgcctga

DBGET integrated database retrieval system