Thermotoga maritima MSB8: THMA_0012 Help Entry THMA_0012         CDS       T03902                                  Name (GenBank) pyruvate synthase   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism tmw  Thermotoga maritima MSB8 Pathway tmw00010   Glycolysis / Gluconeogenesis tmw00020   Citrate cycle (TCA cycle) tmw00620   Pyruvate metabolism tmw00633   Nitrotoluene degradation tmw00640   Propanoate metabolism tmw00650   Butanoate metabolism tmw00680   Methane metabolism tmw01100   Metabolic pathways tmw01110   Biosynthesis of secondary metabolites tmw01120   Microbial metabolism in diverse environments tmw01200   Carbon metabolism tmw01210   2-Oxocarboxylic acid metabolism Module tmw_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:tmw00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     THMA_0012    00020 Citrate cycle (TCA cycle)     THMA_0012    00620 Pyruvate metabolism     THMA_0012    00640 Propanoate metabolism     THMA_0012    00650 Butanoate metabolism     THMA_0012   09102 Energy metabolism    00680 Methane metabolism     THMA_0012   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     THMA_0012 Enzymes [BR:tmw01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      THMA_0012 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_6 Fer4_9 Fer4_7 Fer4_16 Fer4_10 Fer4_2 Fer4_4 Fer4_13 Fer4_3 Fer4_18 Fer4_17 Fer4_15 Fer4_22 Motif Other DBs NCBI-ProteinID:  AKE27825 UniProt:  Q56316 LinkDB All DBs Position 13836..14135 Genome browser AA seq 99 aa AA seqDB search MSLKSWKEIPIGGVIDKPGTAREYKTGAWRVMRPILHKEKCIDCMFCWLYCPDQAIIQEG GIMKGFNYDYCKGCGLCANVCPKQAIEMRPETEFLSEEG NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtctcttaaaagctggaaggaaattcccattggaggagtcatcgacaaaccgggaaca gcaagagaatacaaaacaggtgcctggcgtgtgatgagacctattcttcacaaagagaaa tgtatagactgtatgttctgctggctctactgtccagatcaagcgatcatccaagaaggc ggaataatgaaaggtttcaactacgactactgtaaaggatgcggactctgtgcgaacgta tgtccaaagcaggccatagagatgagacctgagactgagtttctgagcgaggagggatga

DBGET integrated database retrieval system