Thermococcus nautili: BD01_0792 Help Entry BD01_0792         CDS       T03065                                  Name (GenBank) Ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tnu  Thermococcus nautili Pathway tnu00020   Citrate cycle (TCA cycle) tnu00720   Carbon fixation pathways in prokaryotes tnu01100   Metabolic pathways tnu01110   Biosynthesis of secondary metabolites tnu01120   Microbial metabolism in diverse environments tnu01200   Carbon metabolism tnu01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tnu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     BD01_0792   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     BD01_0792 Enzymes [BR:tnu01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      BD01_0792 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_9 Fer4_21 Fer4_2 Fer4_10 Fer4_8 Fer4_6 Fer4_16 Fer4_13 Fer4_4 Fer4_22 ETF_QO Fer4_17 Fer4_3 Fer4_15 Se_S_carrier Motif Other DBs NCBI-ProteinID:  AHL22414 UniProt:  W8PJZ0 LinkDB All DBs Position 697494..697763 Genome browser AA seq 89 aa AA seqDB search MAENANTVVEKNGYLVVGKAEGIVEIDVDTFLCKGCGICVEMCPRKVFEWSKELSEKGVH YPVPVHAEKCVKCKLCELLCPDFAIAVRW NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggccgaaaacgcgaacaccgttgttgaaaaaaacggctaccttgtcgtcggaaaggcg gaaggaatcgttgagattgacgttgatacatttctctgcaagggctgtggaatttgtgtc gagatgtgcccgaggaaggtcttcgagtggagcaaggagctgagcgagaaaggtgtgcac tatccagtccctgttcacgcggagaagtgcgtcaagtgcaagctctgtgaactgctctgc ccggacttcgccatcgcggtaaggtggtga

DBGET integrated database retrieval system