Tomitella fengzijianii: FO059_03565 Help Entry FO059_03565       CDS       T06118                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism toy  Tomitella fengzijianii Pathway toy00261   Monobactam biosynthesis toy01100   Metabolic pathways toy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:toy00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FO059_03565  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:toy01008]     FO059_03565 Polyketide biosynthesis proteins [BR:toy01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FO059_03565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QDQ96582 UniProt:  A0A516X0G8 LinkDB All DBs Position 793341..793610 Genome browser AA seq 89 aa AA seqDB search MSASHGQGPAANPFDDEDSGFLVLVNDEGQHSLWPVFAPVPDGWSVRLGESSRQDAVDFV DRNWTDMRPVSLVHAMDGSPGAPDGERSR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgcatcacacggacagggtcccgccgcgaaccccttcgacgacgaggattccggc ttcctggtgctcgtcaacgacgaggggcagcattccctgtggccggtgttcgcgccggtc cccgacggctggtccgtccgcctcggcgagtcgtcgcggcaggacgccgtggacttcgtg gatcggaactggaccgacatgcggccggtcagcctggtgcatgcgatggacggatcgccc ggagccccggatggggagcggtcgcgatga

DBGET integrated database retrieval system