Thermococcus peptonophilus: A0127_08745 Help Entry A0127_08745       CDS       T04728                                  Name (GenBank) lipoate--protein ligase   KO K03800   lipoate---protein ligase [EC:6.3.1.20] Organism tpep  Thermococcus peptonophilus Pathway tpep00785   Lipoic acid metabolism tpep01100   Metabolic pathways tpep01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:tpep00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00785 Lipoic acid metabolism     A0127_08745 Enzymes [BR:tpep01000]  6. Ligases   6.3  Forming carbon-nitrogen bonds    6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)     6.3.1.20  lipoate---protein ligase      A0127_08745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lip_prot_lig_C DUF3769 Motif Other DBs NCBI-ProteinID:  AMQ19244 UniProt:  A0A142CWU2 LinkDB All DBs Position 1623785..1624063 Genome browser AA seq 92 aa AA seqDB search MKHHVGEHKARKGLIRIEFDEKDGKAENVRITGDFFIHPEETIHELESRLEGHKLEELEG IIDEFFAMRLDVEMPYINVEDFKIALKKALEG NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagcaccacgttggtgagcacaaggccaggaagggcctcataaggatagagttcgac gaaaaggacggaaaggccgaaaacgtcaggataacaggggatttcttcattcatccggag gagacgattcatgaactagaaagcaggcttgaagggcacaagcttgaagagctggaaggg ataatagatgagttcttcgccatgaggctcgacgtcgagatgccctacataaacgtcgag gacttcaagatagcactgaaaaaggccctcgaagggtga

DBGET integrated database retrieval system