Treponema primitia: TREPR_3422 Help Entry TREPR_3422        CDS       T01507                                  Name (GenBank) conserved domain protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tpi  Treponema primitia Pathway tpi00020   Citrate cycle (TCA cycle) tpi01100   Metabolic pathways tpi01110   Biosynthesis of secondary metabolites tpi01120   Microbial metabolism in diverse environments tpi01200   Carbon metabolism tpi01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tpi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     TREPR_3422 Enzymes [BR:tpi01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      TREPR_3422 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_21 Fer4_7 Fer4_2 Fer4_6 Fer4_9 Fer4_15 Fer4_16 Fer4_13 Fer4_4 Fer4_3 Fer4_8 Fer4_22 Motif Other DBs NCBI-ProteinID:  AEF84656 UniProt:  F5YJJ5 LinkDB All DBs Position 732798..733028 Genome browser AA seq 76 aa AA seqDB search MARKGKVVIDRELCKGCYLCIRACPSKVLEKDNKINSGGSYPSVPVRPEDCIACGNCYEM CPDVCIQVFELGEASA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcgagaaaaggtaaggtcgttattgaccgggaattgtgtaaaggatgttatttgtgt atccgggcctgtccgtcaaaagtgctggagaaggacaataaaattaattccggggggtcc tacccctcggttccggtccgcccggaagactgtattgcctgcgggaactgttatgagatg tgtcccgatgtgtgcatccaggtgtttgaactgggggaggcctcggcatga

DBGET integrated database retrieval system