Tsukamurella paurometabola: Tpau_3985 Help Entry Tpau_3985         CDS       T01228                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism tpr  Tsukamurella paurometabola Pathway tpr00261   Monobactam biosynthesis tpr01100   Metabolic pathways tpr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tpr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Tpau_3985  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:tpr01008]     Tpau_3985 Polyketide biosynthesis proteins [BR:tpr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Tpau_3985 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADG80556 UniProt:  D5UN61 LinkDB All DBs Position complement(4103799..4104002) Genome browser AA seq 67 aa AA seqDB search MNNPFDNESGEFVVLINDEGQHSLWPTFRETPKGWRIAFGEGGRSRAECLGYIEQAWTDI RPLSLRA NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaacaatcccttcgataacgagtccggcgagttcgtcgtcctcatcaacgacgagggc cagcactcgttgtggccgaccttccgcgagaccccgaagggatggcgcatcgccttcggc gagggcggccggtcgcgcgccgaatgcctgggctacatcgagcaggcatggacggacatc cgcccgctcagcttgcgcgcctga

DBGET integrated database retrieval system