Tsukamurella paurometabola: Tpau_4318 Help Entry Tpau_4318         CDS       T01228                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism tpr  Tsukamurella paurometabola Pathway tpr00261   Monobactam biosynthesis tpr01100   Metabolic pathways tpr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tpr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Tpau_4318  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:tpr01008]     Tpau_4318 Polyketide biosynthesis proteins [BR:tpr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Tpau_4318 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADG80879 UniProt:  D5UZ32 LinkDB All DBs Position pTpau01:complement(71073..71243) Genome browser AA seq 56 aa AA seqDB search MNPFDDTDALFSVLTNDRGEHSLWPAFAVVPDGWTLVLAPVPHREATEYVQRVWAL NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgaaccccttcgacgacaccgacgccctgttctccgtcctgaccaacgaccgcggcgag cactcgctgtggcccgctttcgcggtggttccggacggctggacgctcgttctggcgccg gtaccgcaccgcgaggccaccgaatacgtacagcgtgtgtgggctttgtga

DBGET integrated database retrieval system