Trifolium pratense (red clover): 55290708 Help Entry 55290708          CDS       T08949                                  Symbol nad4L, HJE17_mgp36 Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism tpra  Trifolium pratense (red clover) Pathway tpra00190   Oxidative phosphorylation tpra01100   Metabolic pathways Module tpra_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:tpra00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     55290708 (nad4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:tpra03029]     55290708 (nad4L) Enzymes [BR:tpra01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      55290708 (nad4L) Mitochondrial biogenesis [BR:tpra03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     55290708 (nad4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 DUF1899 Motif Other DBs NCBI-GeneID:  55290708 NCBI-ProteinID:  YP_009827565 LinkDB All DBs Position MT:83672..83974 Genome browser AA seq 100 aa AA seqDB search MDPIKYFTFSMIISILGIRGILLNRRNIPIMSMPIESMLLAVNSNFLVFSVSSDDMMGQS FASLVSTVAAAESAIGLAIFVITFRVRGTIAVEFINSIQG NT seq 303 nt NT seq  +upstreamnt  +downstreamnt acggatcctatcaaatattttacattttctatgatcatctctattttaggtattcgggga atcctccttaatagacgaaatattcctattatgtcaatgccaattgaatcaatgttatta gctgtgaattcgaactttttggtattttcagtttcttcggatgatatgatgggtcaatca tttgcttcattggtttcaacggtggcagctgcggaatcagctattgggttagccattttc gttataactttccgagtccgagggactattgctgtagaatttattaatagcattcaaggt taa

DBGET integrated database retrieval system